Lineage for d3dawb_ (3daw B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969935Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2969936Protein automated matches [190971] (14 species)
    not a true protein
  7. 2969998Species Mouse (Mus musculus) [TaxId:10090] [225486] (4 PDB entries)
  8. 2970000Domain d3dawb_: 3daw B: [209067]
    Other proteins in same PDB: d3dawa1, d3dawa2
    automated match to d2w0ia_
    complexed with atp, ca

Details for d3dawb_

PDB Entry: 3daw (more details), 2.55 Å

PDB Description: structure of the actin-depolymerizing factor homology domain in complex with actin
PDB Compounds: (B:) Twinfilin-1

SCOPe Domain Sequences for d3dawb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dawb_ d.109.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qgvafpisrdafqaleklskkqlnyvqleidiknetiilantentelrdlpkripkdsar
yhfflykhshegdylesvvfiysmpgytcsirermlysscksplleiverqlqmdvirki
eidngdeltadflydevhpk

SCOPe Domain Coordinates for d3dawb_:

Click to download the PDB-style file with coordinates for d3dawb_.
(The format of our PDB-style files is described here.)

Timeline for d3dawb_: