Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (14 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225486] (4 PDB entries) |
Domain d3dawb_: 3daw B: [209067] Other proteins in same PDB: d3dawa1, d3dawa2 automated match to d2w0ia_ complexed with atp, ca |
PDB Entry: 3daw (more details), 2.55 Å
SCOPe Domain Sequences for d3dawb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dawb_ d.109.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qgvafpisrdafqaleklskkqlnyvqleidiknetiilantentelrdlpkripkdsar yhfflykhshegdylesvvfiysmpgytcsirermlysscksplleiverqlqmdvirki eidngdeltadflydevhpk
Timeline for d3dawb_: