Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [225468] (1 PDB entry) |
Domain d3dahb1: 3dah B:5-165 [209054] automated match to d1dkua1 complexed with amp, po4 |
PDB Entry: 3dah (more details), 2.3 Å
SCOPe Domain Sequences for d3dahb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dahb1 c.61.1.0 (B:5-165) automated matches {Burkholderia pseudomallei [TaxId: 320372]} dglmvftgnanpalaqevvkilgiplgkamvsrfsdgeiqveiqenvrgkdvfvlqstca ptndnlmelmimvdalkrasagritaaipyfgyarqdrrprsarvaisakvvanmleiag veriitmdlhadqiqgffdipvdniyatpillgdlrkqnyp
Timeline for d3dahb1:
View in 3D Domains from other chains: (mouse over for more information) d3daha1, d3daha2, d3dahc1, d3dahc2 |