Lineage for d3dahb1 (3dah B:5-165)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891938Species Burkholderia pseudomallei [TaxId:320372] [225468] (1 PDB entry)
  8. 2891941Domain d3dahb1: 3dah B:5-165 [209054]
    automated match to d1dkua1
    complexed with amp, po4

Details for d3dahb1

PDB Entry: 3dah (more details), 2.3 Å

PDB Description: 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei
PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d3dahb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dahb1 c.61.1.0 (B:5-165) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
dglmvftgnanpalaqevvkilgiplgkamvsrfsdgeiqveiqenvrgkdvfvlqstca
ptndnlmelmimvdalkrasagritaaipyfgyarqdrrprsarvaisakvvanmleiag
veriitmdlhadqiqgffdipvdniyatpillgdlrkqnyp

SCOPe Domain Coordinates for d3dahb1:

Click to download the PDB-style file with coordinates for d3dahb1.
(The format of our PDB-style files is described here.)

Timeline for d3dahb1: