SCOPe 2.08: Domain d3d6ga1: 3d6g A:236-339

Lineage for d3d6ga1 (3d6g A:236-339)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d3d6ga1: 3d6g A:236-339 [209025]
   Other proteins in same PDB: d3d6ga2, d3d6gb2
   automated match to d2ql1a1
   complexed with x12

Details for d3d6ga1

PDB Entry: 3d6g, 2.3 Å

PDB Description: fc fragment of igg1 (herceptin) with protein-a mimetic peptide dendrimer ligand.

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3d6ga1:

Sequence; same for both SEQRES and ATOM records:

>d3d6ga1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d3d6ga1:

• d3d6ga1 first appeared in SCOPe 2.03
  
• d3d6ga1 appears in SCOPe 2.07