Lineage for d3d6ba1 (3d6b A:4-242)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1691655Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1691656Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1691797Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1691798Protein automated matches [226934] (17 species)
    not a true protein
  7. 1691818Species Burkholderia pseudomallei [TaxId:320372] [225462] (6 PDB entries)
  8. 1691831Domain d3d6ba1: 3d6b A:4-242 [209017]
    Other proteins in same PDB: d3d6ba2, d3d6bb2, d3d6bc2, d3d6bd2
    automated match to d1siqa2
    complexed with 54d

Details for d3d6ba1

PDB Entry: 3d6b (more details), 2.21 Å

PDB Description: 2.2 a crystal structure of glutaryl-coa dehydrogenase from burkholderia pseudomallei
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3d6ba1:

Sequence, based on SEQRES records: (download)

>d3d6ba1 e.6.1.0 (A:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepnhgsdpgsmvtrarkvpggyslsgskmwitnspiadvfvvwa
kldedgrdeirgfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

Sequence, based on observed residues (ATOM records): (download)

>d3d6ba1 e.6.1.0 (A:4-242) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
atfhwddpllldqqladdermvrdaahayaqgklaprvteafrhettdaaifremgeigl
lgptipeqyggpgldyvsygliarevervdsgyrsmmsvqsslvmvpifefgsdaqkeky
lpklatgewigcfgltepmvtrarkvpggyslsgskmwitnspiadvfvvwakldedeir
gfilekgckglsapaihgkvglrasitgeivldeafvpeenilphvkg

SCOPe Domain Coordinates for d3d6ba1:

Click to download the PDB-style file with coordinates for d3d6ba1.
(The format of our PDB-style files is described here.)

Timeline for d3d6ba1: