Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [188646] (7 PDB entries) |
Domain d3d5tc1: 3d5t C:3-156 [209006] Other proteins in same PDB: d3d5ta2, d3d5tb2, d3d5tc2, d3d5td2 automated match to d1b8pa1 complexed with mg, na |
PDB Entry: 3d5t (more details), 2.51 Å
SCOPe Domain Sequences for d3d5tc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d5tc1 c.2.1.0 (C:3-156) automated matches {Burkholderia pseudomallei [TaxId: 320372]} kpakrvavtgaagqiaysllfriangdllgkdqpvilqlldlpqaqaavkgvvmelddca fpllagvvitddpkvafkdadvallvgarprskgmerkdllsanaeiftvqgaalnevas rdvkvlvvgnpantnayiamksapdlpkknftam
Timeline for d3d5tc1: