Lineage for d3d4jb2 (3d4j B:194-396)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654323Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 1654403Family d.58.26.0: automated matches [227186] (1 protein)
    not a true family
  6. 1654404Protein automated matches [226908] (3 species)
    not a true protein
  7. 1654405Species Human (Homo sapiens) [TaxId:9606] [225567] (1 PDB entry)
  8. 1654407Domain d3d4jb2: 3d4j B:194-396 [208992]
    Other proteins in same PDB: d3d4ja1, d3d4jb1
    automated match to d1fi4a2
    complexed with so4

Details for d3d4jb2

PDB Entry: 3d4j (more details), 2.4 Å

PDB Description: Crystal structure of Human mevalonate diphosphate decarboxylase
PDB Compounds: (B:) Diphosphomevalonate decarboxylase

SCOPe Domain Sequences for d3d4jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d4jb2 d.58.26.0 (B:194-396) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elrvlilvvsaekkltgstvgmrasvetspllrfraesvvparmaemarcirerdfpsfa
qltmkdsnqfhatcldtfppisylnaiswriihlvhrfnahhgdtkvaytfdagpnavif
tlddtvaefvaavwhgfppgsngdtflkglqvrpaplsaelqaalameptpggvkyiivt
qvgpgpqilddpcahllgpdglp

SCOPe Domain Coordinates for d3d4jb2:

Click to download the PDB-style file with coordinates for d3d4jb2.
(The format of our PDB-style files is described here.)

Timeline for d3d4jb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d4jb1