Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189350] (4 PDB entries) |
Domain d3d4jb1: 3d4j B:9-193 [208991] Other proteins in same PDB: d3d4ja2, d3d4jb2 automated match to d1fi4a1 complexed with so4 |
PDB Entry: 3d4j (more details), 2.4 Å
SCOPe Domain Sequences for d3d4jb1:
Sequence, based on SEQRES records: (download)
>d3d4jb1 d.14.1.0 (B:9-193) automated matches {Human (Homo sapiens) [TaxId: 9606]} avtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdftedriwln greedvgqprlqaclreirclarkrrnsrdgdplpsslsckvhvasvnnfptaaglassa agyaclaytlarvygvesdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqvap eshwp
>d3d4jb1 d.14.1.0 (B:9-193) automated matches {Human (Homo sapiens) [TaxId: 9606]} avtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdftedriwln greedvgqprlqaclreirclackvhvasvnnfptlassaagyaclaytlarvygvesdl sevarrgsgsacrslyggfvewqmgeqadgkdsiarqvapeshwp
Timeline for d3d4jb1: