Lineage for d3d4jb1 (3d4j B:9-193)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891698Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1891699Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1892409Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1892410Protein automated matches [190826] (17 species)
    not a true protein
  7. 1892469Species Human (Homo sapiens) [TaxId:9606] [189350] (4 PDB entries)
  8. 1892479Domain d3d4jb1: 3d4j B:9-193 [208991]
    Other proteins in same PDB: d3d4ja2, d3d4jb2
    automated match to d1fi4a1
    complexed with so4

Details for d3d4jb1

PDB Entry: 3d4j (more details), 2.4 Å

PDB Description: Crystal structure of Human mevalonate diphosphate decarboxylase
PDB Compounds: (B:) Diphosphomevalonate decarboxylase

SCOPe Domain Sequences for d3d4jb1:

Sequence, based on SEQRES records: (download)

>d3d4jb1 d.14.1.0 (B:9-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdftedriwln
greedvgqprlqaclreirclarkrrnsrdgdplpsslsckvhvasvnnfptaaglassa
agyaclaytlarvygvesdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqvap
eshwp

Sequence, based on observed residues (ATOM records): (download)

>d3d4jb1 d.14.1.0 (B:9-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avtctapvniavikywgkrdeelvlpinsslsvtlhqdqlkttttaviskdftedriwln
greedvgqprlqaclreirclackvhvasvnnfptlassaagyaclaytlarvygvesdl
sevarrgsgsacrslyggfvewqmgeqadgkdsiarqvapeshwp

SCOPe Domain Coordinates for d3d4jb1:

Click to download the PDB-style file with coordinates for d3d4jb1.
(The format of our PDB-style files is described here.)

Timeline for d3d4jb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d4jb2