Lineage for d3d0ob2 (3d0o B:149-313)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999754Species Staphylococcus aureus [TaxId:93062] [225656] (3 PDB entries)
  8. 2999756Domain d3d0ob2: 3d0o B:149-313 [208982]
    Other proteins in same PDB: d3d0oa1, d3d0ob1
    automated match to d2ldba2

Details for d3d0ob2

PDB Entry: 3d0o (more details), 1.8 Å

PDB Description: crystal structure of lactate dehydrogenase from staphylococcus aureus
PDB Compounds: (B:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d3d0ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d0ob2 d.162.1.0 (B:149-313) automated matches {Staphylococcus aureus [TaxId: 93062]}
tildsarfrlllseafdvaprsvdaqiigehgdtelpvwshaniagqplktlleqrpegk
aqieqifvqtrdaaydiiqakgatyygvamglariteaifrnedavltvsallegeyeee
dvyigvpavinrngirnvveiplndeeqskfahsaktlkdimaea

SCOPe Domain Coordinates for d3d0ob2:

Click to download the PDB-style file with coordinates for d3d0ob2.
(The format of our PDB-style files is described here.)

Timeline for d3d0ob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d0ob1