Lineage for d3cwva1 (3cwv A:8-206)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1925132Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1925133Protein automated matches [226867] (13 species)
    not a true protein
  7. 1925201Species Myxococcus xanthus [TaxId:246197] [225452] (1 PDB entry)
  8. 1925202Domain d3cwva1: 3cwv A:8-206 [208972]
    Other proteins in same PDB: d3cwva2, d3cwvb2
    automated match to d1ei1a2

Details for d3cwva1

PDB Entry: 3cwv (more details), 1.95 Å

PDB Description: crystal structure of b-subunit of the dna gyrase from myxococcus xanthus
PDB Compounds: (A:) DNA gyrase, B subunit, truncated

SCOPe Domain Sequences for d3cwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cwva1 d.122.1.0 (A:8-206) automated matches {Myxococcus xanthus [TaxId: 246197]}
ggivenvrkrpgmycgdvgeyglhhlvyflldvayeearrgecrdvvlevggdgsialfc
tsrtvtaenlvrvatgagflgrppgdgwgwdsmlvvslalssryqvdiwadgrqwrvmge
hghpqgegaavtpmepmpvsaergvrvhfvpdatifevlafdrarlsrrcnelaalapgl
rvsfadlqrgertlwhlpg

SCOPe Domain Coordinates for d3cwva1:

Click to download the PDB-style file with coordinates for d3cwva1.
(The format of our PDB-style files is described here.)

Timeline for d3cwva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cwva2