SCOP 1.63: Domain d1hilb2: 1hil B:113-228

Lineage for d1hilb2 (1hil B:113-228)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries)

8. Domain d1hilb2: 1hil B:113-228 [20897]
   Other proteins in same PDB: d1hila1, d1hilb1, d1hilc1, d1hild1

Details for d1hilb2

PDB Entry: 1hil, 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

SCOP Domain Sequences for d1hilb2:

Sequence, based on SEQRES records:

>d1hilb2 b.1.1.2 (B:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
aakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records):

>d1hilb2 b.1.1.2 (B:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
aakttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1hilb2:

• d1hilb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hilb2 appears in SCOP 1.61
  
• d1hilb2 appears in SCOP 1.65
  
• d1hilb2 appears in the current release, SCOPe 2.08