Lineage for d3cwea_ (3cwe A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1367719Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1367720Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1367797Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1367837Protein Tyrosine phosphatase [52806] (7 species)
  7. 1367838Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (110 PDB entries)
    Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299
  8. 1367840Domain d3cwea_: 3cwe A: [208969]
    automated match to d2cm2a_
    complexed with 825, mg

Details for d3cwea_

PDB Entry: 3cwe (more details), 1.6 Å

PDB Description: PTP1B in complex with a phosphonic acid inhibitor
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d3cwea_:

Sequence, based on SEQRES records: (download)

>d3cwea_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
aadklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfd
hsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrv
mekgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilh
fhyttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtcll
lmdkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

Sequence, based on observed residues (ATOM records): (download)

>d3cwea_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
aadklefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfd
hsriklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrv
mkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhytt
wpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkr
kdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimg

SCOPe Domain Coordinates for d3cwea_:

Click to download the PDB-style file with coordinates for d3cwea_.
(The format of our PDB-style files is described here.)

Timeline for d3cwea_: