Lineage for d3cw2g1 (3cw2 G:1-84)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789725Protein Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain [74950] (3 species)
  7. 2789731Species Sulfolobus solfataricus [TaxId:2287] [141310] (2 PDB entries)
    Uniprot Q97Z79 1-84
  8. 2789734Domain d3cw2g1: 3cw2 G:1-84 [208963]
    Other proteins in same PDB: d3cw2a1, d3cw2a2, d3cw2a3, d3cw2b1, d3cw2b2, d3cw2b3, d3cw2c2, d3cw2c3, d3cw2d2, d3cw2d3, d3cw2e1, d3cw2e2, d3cw2e3, d3cw2f1, d3cw2f2, d3cw2f3, d3cw2g2, d3cw2g3, d3cw2h2, d3cw2h3
    automated match to d2ahob2

Details for d3cw2g1

PDB Entry: 3cw2 (more details), 2.8 Å

PDB Description: crystal structure of the intact archaeal translation initiation factor 2 from sulfolobus solfataricus .
PDB Compounds: (G:) Translation initiation factor 2 subunit alpha

SCOPe Domain Sequences for d3cw2g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cw2g1 b.40.4.5 (G:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
miysrsklpsegeiliatvkqvfdygsyvsldeygglqaflpwsevsskwvknirdvlke
nrkvivkvirvdrrkgtvdvslkk

SCOPe Domain Coordinates for d3cw2g1:

Click to download the PDB-style file with coordinates for d3cw2g1.
(The format of our PDB-style files is described here.)

Timeline for d3cw2g1: