SCOPe 2.05: Domain d1hila2: 1hil A:109-211

Lineage for d1hila2 (1hil A:109-211)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

Domain d1hila2: 1hil A:109-211 [20896]
Other proteins in same PDB: d1hila1, d1hilb1, d1hilb2, d1hilc1, d1hild1, d1hild2
part of Fab 17/9

Details for d1hila2

PDB Entry: 1hil (more details), 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

PDB Compounds: (A:) igg2a-kappa 17/9 fab (light chain)

SCOPe Domain Sequences for d1hila2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hila2 b.1.1.2 (A:109-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d1hila2:

Click to download the PDB-style file with coordinates for d1hila2.
(The format of our PDB-style files is described here.)

Timeline for d1hila2: