Lineage for d1hila2 (1hil A:109-211)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159514Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries)
  8. 159515Domain d1hila2: 1hil A:109-211 [20896]
    Other proteins in same PDB: d1hila1, d1hilb1, d1hilc1, d1hild1

Details for d1hila2

PDB Entry: 1hil (more details), 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

SCOP Domain Sequences for d1hila2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hila2 b.1.1.2 (A:109-211) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1hila2:

Click to download the PDB-style file with coordinates for d1hila2.
(The format of our PDB-style files is described here.)

Timeline for d1hila2: