Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab 17/9 (mouse), kappa L chain [48980] (4 PDB entries) |
Domain d1hila2: 1hil A:109-211 [20896] Other proteins in same PDB: d1hila1, d1hilb1, d1hilc1, d1hild1 |
PDB Entry: 1hil (more details), 2 Å
SCOP Domain Sequences for d1hila2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hila2 b.1.1.2 (A:109-211) Immunoglobulin (constant domains of L and H chains) {Fab 17/9 (mouse), kappa L chain} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1hila2: