SCOPe 2.06: Domain d3cu5b1: 3cu5 B:4-130

Lineage for d3cu5b1 (3cu5 B:4-130)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Clostridium phytofermentans [TaxId:357809] [225451] (1 PDB entry)

8. Domain d3cu5b1: 3cu5 B:4-130 [208954]
   Other proteins in same PDB: d3cu5a2, d3cu5b2
   automated match to d3crnb_

Details for d3cu5b1

PDB Entry: 3cu5, 2.6 Å

PDB Description: crystal structure of a two component transcriptional regulator arac from clostridium phytofermentans isdg

PDB Compounds: (B:) Two component transcriptional regulator, AraC family

SCOPe Domain Sequences for d3cu5b1:

Sequence; same for both SEQRES and ATOM records:

>d3cu5b1 c.23.1.0 (B:4-130) automated matches {Clostridium phytofermentans [TaxId: 357809]}
rilivddekltrdglianinwkalsfdqidqaddginaiqialkhppnvlltdvrmprmd
gielvdnilklypdcsvifmsgysdkeylkaaikfrairyvekpidpseimdalkqsiqt
vlqhqaq

Timeline for d3cu5b1:

• d3cu5b1 first appeared in SCOPe 2.03, called d3cu5b_
  
• d3cu5b1 was called d3cu5b_ in SCOPe 2.05
  
• d3cu5b1 appears in SCOPe 2.07
  
• d3cu5b1 appears in the current release, SCOPe 2.08