SCOPe 2.06: Domain d1bbjh2: 1bbj H:116-212

Lineage for d1bbjh2 (1bbj H:116-212)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

Domain d1bbjh2: 1bbj H:116-212 [20895]
Other proteins in same PDB: d1bbja1, d1bbja2, d1bbjb1, d1bbjh1, d1bbjl1, d1bbjl2
part of humanized Fab B72.3

Details for d1bbjh2

PDB Entry: 1bbj (more details), 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

PDB Compounds: (H:) igg4-kappa b72.3 fab (heavy chain)

SCOPe Domain Sequences for d1bbjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbjh2 b.1.1.2 (H:116-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtktytcnvdhkpsntkvdkrv

SCOPe Domain Coordinates for d1bbjh2:

Click to download the PDB-style file with coordinates for d1bbjh2.
(The format of our PDB-style files is described here.)

Timeline for d1bbjh2: