Lineage for d1bbjh2 (1bbj H:116-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104093Species Fab B72.3 (mouse/human chimera), kappa L chain [48979] (1 PDB entry)
  8. 104094Domain d1bbjh2: 1bbj H:116-212 [20895]
    Other proteins in same PDB: d1bbjh1, d1bbjl1

Details for d1bbjh2

PDB Entry: 1bbj (more details), 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

SCOP Domain Sequences for d1bbjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbjh2 b.1.1.2 (H:116-212) Immunoglobulin (constant domains of L and H chains) {Fab B72.3 (mouse/human chimera), kappa L chain}
stkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtktytcnvdhkpsntkvdkrv

SCOP Domain Coordinates for d1bbjh2:

Click to download the PDB-style file with coordinates for d1bbjh2.
(The format of our PDB-style files is described here.)

Timeline for d1bbjh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bbjh1