SCOPe 2.03: Domain d3ct2b2: 3ct2 B:133-375

Lineage for d3ct2b2 (3ct2 B:133-375)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:220664] [225447] (3 PDB entries)

8. Domain d3ct2b2: 3ct2 B:133-375 [208944]
   Other proteins in same PDB: d3ct2a1, d3ct2b1
   automated match to d1f9ca1
   complexed with mg

Details for d3ct2b2

PDB Entry: 3ct2, 1.8 Å

PDB Description: crystal structure of muconate cycloisomerase from pseudomonas fluorescens

PDB Compounds: (B:) Muconate cycloisomerase

SCOPe Domain Sequences for d3ct2b2:

Sequence; same for both SEQRES and ATOM records:

>d3ct2b2 c.1.11.0 (B:133-375) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
rvrdalpvawtlasgdtakdiaeaqkmldlrrhrifklkigagevdrdlahviaikkalg
dsasvrvdvnqawdeavalracrilggngidlieqpisrnnragmvrlnasspapimade
siecvedafnlaregaasvfalkiaknggpratlrtaaiaeaagiglyggtmleggigtl
asahafltlnklswdtelfgpllltedilaeppvyrdfhlhvskapglglsldeerlaff
rre

Timeline for d3ct2b2:

• d3ct2b2 is new in SCOPe 2.03-stable
  
• d3ct2b2 appears in SCOPe 2.04
  
• d3ct2b2 appears in the current release, SCOPe 2.08