SCOP 1.55: Domain d1bbjl2: 1bbj L:110-211

Lineage for d1bbjl2 (1bbj L:110-211)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab B72.3 (mouse/human chimera), kappa L chain [48979] (1 PDB entry)

8. Domain d1bbjl2: 1bbj L:110-211 [20894]
   Other proteins in same PDB: d1bbjh1, d1bbjl1

Details for d1bbjl2

PDB Entry: 1bbj, 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

SCOP Domain Sequences for d1bbjl2:

Sequence; same for both SEQRES and ATOM records:

>d1bbjl2 b.1.1.2 (L:110-211) Immunoglobulin (constant domains of L and H chains) {Fab B72.3 (mouse/human chimera), kappa L chain}
daaptvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1bbjl2:

• d1bbjl2 appears in SCOP 1.57
  
• d1bbjl2 appears in the current release, SCOPe 2.08