SCOPe 2.03: Domain d3crua1: 3cru A:1-80

Lineage for d3crua1 (3cru A:1-80)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (14 PDB entries)
   Uniprot P08515

8. Domain d3crua1: 3cru A:1-80 [208937]
   Other proteins in same PDB: d3crua2
   automated match to d1m9aa2
   complexed with gsh

Details for d3crua1

PDB Entry: 3cru, 2.3 Å

PDB Description: structural characterization of an engineered allosteric protein

PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d3crua1:

Sequence; same for both SEQRES and ATOM records:

>d3crua1 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelgcefpnlpyyid
gdvkltqsmaiiryiadkhn

Timeline for d3crua1:

• d3crua1 is new in SCOPe 2.03-stable
  
• d3crua1 appears in SCOPe 2.04
  
• d3crua1 appears in the current release, SCOPe 2.08