SCOPe 2.08: Domain d3cota_: 3cot A:

Lineage for d3cota_ (3cot A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188399] (46 PDB entries)

8. Domain d3cota_: 3cot A: [208918]
   automated match to d3caqb_
   complexed with nap, str

Details for d3cota_

PDB Entry: 3cot, 2.03 Å

PDB Description: Crystal structure of human liver delta(4)-3-ketosteroid 5beta-reductase (akr1d1) in complex with progesterone and nadp. Resolution: 2.03 A.

PDB Compounds: (A:) 3-oxo-5-beta-steroid 4-dehydrogenase

SCOPe Domain Sequences for d3cota_:

Sequence; same for both SEQRES and ATOM records:

>d3cota_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqne
hevgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiiev
pmafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqleliln
kpglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkd
allnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdiea
lnknvrfvellmwrdhpeypfhdey

Timeline for d3cota_:

• d3cota_ first appeared in SCOPe 2.03
  
• d3cota_ appears in SCOPe 2.07