Lineage for d1a3rh2 (1a3r H:120-228)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104043Species Fab 8F5 (mouse), kappa L chain [48978] (2 PDB entries)
  8. 104044Domain d1a3rh2: 1a3r H:120-228 [20891]
    Other proteins in same PDB: d1a3rh1, d1a3rl1

Details for d1a3rh2

PDB Entry: 1a3r (more details), 2.1 Å

PDB Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)

SCOP Domain Sequences for d1a3rh2:

Sequence, based on SEQRES records: (download)

>d1a3rh2 b.1.1.2 (H:120-228) Immunoglobulin (constant domains of L and H chains) {Fab 8F5 (mouse), kappa L chain}
svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1a3rh2 b.1.1.2 (H:120-228) Immunoglobulin (constant domains of L and H chains) {Fab 8F5 (mouse), kappa L chain}
svyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlsssvtvt
sstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1a3rh2:

Click to download the PDB-style file with coordinates for d1a3rh2.
(The format of our PDB-style files is described here.)

Timeline for d1a3rh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a3rh1