SCOPe 2.03: Domain d3ckyb2: 3cky B:167-299

Lineage for d3ckyb2 (3cky B:167-299)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (23 species)
   not a true protein

7. Species Eubacterium barkeri [TaxId:1528] [225506] (1 PDB entry)

8. Domain d3ckyb2: 3cky B:167-299 [208893]
   Other proteins in same PDB: d3ckya1, d3ckyb1, d3ckyc1, d3ckyd1
   automated match to d2cvza1

Details for d3ckyb2

PDB Entry: 3cky, 2.3 Å

PDB Description: Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation

PDB Compounds: (B:) 2-hydroxymethyl glutarate dehydrogenase

SCOPe Domain Sequences for d3ckyb2:

Sequence; same for both SEQRES and ATOM records:

>d3ckyb2 a.100.1.0 (B:167-299) automated matches {Eubacterium barkeri [TaxId: 1528]}
tgagdavkivnnlllgcnmaslaealvlgvkcglkpetmqeiigkssgrsyameakmekf
imsgdfaggfamdlqhkdlglaleagkegnvplpmtamatqifeggramglgredmsavi
kvweqmtgvsvsg

Timeline for d3ckyb2:

• d3ckyb2 is new in SCOPe 2.03-stable
  
• d3ckyb2 appears in SCOPe 2.04
  
• d3ckyb2 appears in the current release, SCOPe 2.08