SCOPe 2.08: Domain d3ckyb1: 3cky B:4-166

Lineage for d3ckyb1 (3cky B:4-166)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Eubacterium barkeri [TaxId:1528] [225505] (1 PDB entry)

8. Domain d3ckyb1: 3cky B:4-166 [208892]
   Other proteins in same PDB: d3ckya2, d3ckyb2, d3ckyc2, d3ckyd2
   automated match to d2cvza2

Details for d3ckyb1

PDB Entry: 3cky, 2.3 Å

PDB Description: Structural and Kinetic Properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation

PDB Compounds: (B:) 2-hydroxymethyl glutarate dehydrogenase

SCOPe Domain Sequences for d3ckyb1:

Sequence; same for both SEQRES and ATOM records:

>d3ckyb1 c.2.1.0 (B:4-166) automated matches {Eubacterium barkeri [TaxId: 1528]}
sikigfiglgamgkpmainllkegvtvyafdlmeanvaavvaqgaqacennqkvaaasdi
iftslpnagivetvmngpggvlsackagtvivdmssvspsstlkmakvaaekgidyvdap
vsggtkgaeagtltimvgaseavfekiqpvlsvigkdiyhvgd

Timeline for d3ckyb1:

• d3ckyb1 first appeared in SCOPe 2.03
  
• d3ckyb1 appears in SCOPe 2.07