Lineage for d3cg0d_ (3cg0 D:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356465Species Desulfovibrio desulfuricans [TaxId:207559] [225424] (1 PDB entry)
  8. 1356469Domain d3cg0d_: 3cg0 D: [208880]
    automated match to d3c3ma_

Details for d3cg0d_

PDB Entry: 3cg0 (more details), 2.15 Å

PDB Description: crystal structure of signal receiver domain of modulated diguanylate cyclase from desulfovibrio desulfuricans g20, an example of alternate folding
PDB Compounds: (D:) Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor

SCOPe Domain Sequences for d3cg0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cg0d_ c.23.1.0 (D:) automated matches {Desulfovibrio desulfuricans [TaxId: 207559]}
dlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialvdimlcga
ldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhrsiemaih
kkklee

SCOPe Domain Coordinates for d3cg0d_:

Click to download the PDB-style file with coordinates for d3cg0d_.
(The format of our PDB-style files is described here.)

Timeline for d3cg0d_: