SCOPe 2.06: Domain d3cg0a1: 3cg0 A:6-130

Lineage for d3cg0a1 (3cg0 A:6-130)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Desulfovibrio desulfuricans [TaxId:207559] [225424] (1 PDB entry)

8. Domain d3cg0a1: 3cg0 A:6-130 [208877]
   Other proteins in same PDB: d3cg0a2, d3cg0b2, d3cg0c2, d3cg0d2
   automated match to d3c3ma_

Details for d3cg0a1

PDB Entry: 3cg0, 2.15 Å

PDB Description: crystal structure of signal receiver domain of modulated diguanylate cyclase from desulfovibrio desulfuricans g20, an example of alternate folding

PDB Compounds: (A:) Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor

SCOPe Domain Sequences for d3cg0a1:

Sequence; same for both SEQRES and ATOM records:

>d3cg0a1 c.23.1.0 (A:6-130) automated matches {Desulfovibrio desulfuricans [TaxId: 207559]}
dlpgvlivedgrlaaatlriqleslgydvlgvfdngeeavrcapdlrpdialvdimlcga
ldgvetaarlaagcnlpiifitssqdvetfqrakrvnpfgylakpvaadtlhrsiemaih
kkkle

Timeline for d3cg0a1:

• d3cg0a1 first appeared in SCOPe 2.03, called d3cg0a_
  
• d3cg0a1 was called d3cg0a_ in SCOPe 2.05
  
• d3cg0a1 appears in SCOPe 2.07
  
• d3cg0a1 appears in the current release, SCOPe 2.08