SCOPe 2.08: Domain d3cfwa1: 3cfw A:1-118

Lineage for d3cfwa1 (3cfw A:1-118)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein automated matches [190329] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187151] (10 PDB entries)

8. Domain d3cfwa1: 3cfw A:1-118 [208875]
   Other proteins in same PDB: d3cfwa2
   automated match to d1g1sa1
   complexed with ca, nag

Details for d3cfwa1

PDB Entry: 3cfw, 2.2 Å

PDB Description: l-selectin lectin and egf domains

PDB Compounds: (A:) L-selectin

SCOPe Domain Sequences for d3cfwa1:

Sequence; same for both SEQRES and ATOM records:

>d3cfwa1 d.169.1.1 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wtyhysekpmnwqrarrfcrdnytdlvaiqnkaeieylektlpfsrsyywigirkiggiw
twvgtnkslteeaenwgdgepnnkknkedcveiyikrnkdagkwnddachklkaalcy

Timeline for d3cfwa1:

• d3cfwa1 first appeared in SCOPe 2.03
  
• d3cfwa1 appears in SCOPe 2.07