Lineage for d3cfda1 (3cfd A:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034840Domain d3cfda1: 3cfd A:1-107 [208867]
    Other proteins in same PDB: d3cfda2, d3cfdl2
    automated match to d1dqdl1
    complexed with gol, spb

Details for d3cfda1

PDB Entry: 3cfd (more details), 2.5 Å

PDB Description: Purple-fluorescent antibody EP2-25C10 in complex with its stilbene hapten
PDB Compounds: (A:) purple-fluorescent antibody ep2-25c10-kappa light chain

SCOPe Domain Sequences for d3cfda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfda1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdysltisnldqddiatyfcqqgttlpptfgggtkleik

SCOPe Domain Coordinates for d3cfda1:

Click to download the PDB-style file with coordinates for d3cfda1.
(The format of our PDB-style files is described here.)

Timeline for d3cfda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cfda2