Lineage for d3cfba2 (3cfb A:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763637Domain d3cfba2: 3cfb A:108-213 [208862]
    Other proteins in same PDB: d3cfba1, d3cfbl1
    automated match to d1dqdl2
    complexed with gol, spb

Details for d3cfba2

PDB Entry: 3cfb (more details), 1.6 Å

PDB Description: High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene hapten at 100K
PDB Compounds: (A:) blue fluorescent antibody ep2-19g2-kappa light chain

SCOPe Domain Sequences for d3cfba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfba2 b.1.1.2 (A:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3cfba2:

Click to download the PDB-style file with coordinates for d3cfba2.
(The format of our PDB-style files is described here.)

Timeline for d3cfba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cfba1