SCOPe 2.05: Domain d7fabl2: 7fab L:104-204

Lineage for d7fabl2 (7fab L:104-204)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)

8. Domain d7fabl2: 7fab L:104-204 [20886]
   Other proteins in same PDB: d7fabh1, d7fabh2, d7fabl1
   part of Fab NEW

Details for d7fabl2

PDB Entry: 7fab, 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution

PDB Compounds: (L:) igg1-lambda new fab (light chain)

SCOPe Domain Sequences for d7fabl2:

Sequence; same for both SEQRES and ATOM records:

>d7fabl2 b.1.1.2 (L:104-204) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvap

Timeline for d7fabl2:

• d7fabl2 first appeared (with stable ids) in SCOP 1.55
  
• d7fabl2 appears in SCOPe 2.04
  
• d7fabl2 appears in SCOPe 2.06
  
• d7fabl2 appears in the current release, SCOPe 2.08