Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
Domain d7fabl2: 7fab L:104-204 [20886] Other proteins in same PDB: d7fabh1, d7fabh2, d7fabl1 part of Fab NEW |
PDB Entry: 7fab (more details), 2 Å
SCOPe Domain Sequences for d7fabl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7fabl2 b.1.1.2 (L:104-204) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshksyscqvthegstvektvap
Timeline for d7fabl2: