Lineage for d7fabl2 (7fab L:104-204)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159963Species Fab NEW (human), lambda L chain [48976] (1 PDB entry)
  8. 159965Domain d7fabl2: 7fab L:104-204 [20886]
    Other proteins in same PDB: d7fabh1, d7fabl1

Details for d7fabl2

PDB Entry: 7fab (more details), 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution

SCOP Domain Sequences for d7fabl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7fabl2 b.1.1.2 (L:104-204) Immunoglobulin (constant domains of L and H chains) {Fab NEW (human), lambda L chain}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvap

SCOP Domain Coordinates for d7fabl2:

Click to download the PDB-style file with coordinates for d7fabl2.
(The format of our PDB-style files is described here.)

Timeline for d7fabl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7fabl1