Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab NEW (human), lambda L chain [48976] (1 PDB entry) |
Domain d7fabl2: 7fab L:104-204 [20886] Other proteins in same PDB: d7fabh1, d7fabl1 |
PDB Entry: 7fab (more details), 2 Å
SCOP Domain Sequences for d7fabl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7fabl2 b.1.1.2 (L:104-204) Immunoglobulin (constant domains of L and H chains) {Fab NEW (human), lambda L chain} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvetttpskq snnkyaassylsltpeqwkshksyscqvthegstvektvap
Timeline for d7fabl2: