Lineage for d7fabl2 (7fab L:104-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749548Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2749552Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2749558Domain d7fabl2: 7fab L:104-204 [20886]
    Other proteins in same PDB: d7fabh1, d7fabh2, d7fabl1
    part of Fab NEW

Details for d7fabl2

PDB Entry: 7fab (more details), 2 Å

PDB Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution
PDB Compounds: (L:) igg1-lambda new fab (light chain)

SCOPe Domain Sequences for d7fabl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7fabl2 b.1.1.2 (L:104-204) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvap

SCOPe Domain Coordinates for d7fabl2:

Click to download the PDB-style file with coordinates for d7fabl2.
(The format of our PDB-style files is described here.)

Timeline for d7fabl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7fabl1