Lineage for d3cbqa_ (3cbq A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598123Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)
  8. 1598141Domain d3cbqa_: 3cbq A: [208851]
    automated match to d3dz8a_
    complexed with edo, gdp, mg, unx

Details for d3cbqa_

PDB Entry: 3cbq (more details), 1.82 Å

PDB Description: crystal structure of the human rem2 gtpase with bound gdp
PDB Compounds: (A:) GTP-binding protein REM 2

SCOPe Domain Sequences for d3cbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbqa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gifkvmlvgesgvgkstlagtfgglqgdsahepenpedtyerrimvdkeevtlvvydiwe
qgdaggwlrdhclqtgdaflivfsvtdrrsfskvpetllrlragrphhdlpvilvgnksd
larsrevsleegrhlagtlsckhietsaalhhntrelfegavrqirlrr

SCOPe Domain Coordinates for d3cbqa_:

Click to download the PDB-style file with coordinates for d3cbqa_.
(The format of our PDB-style files is described here.)

Timeline for d3cbqa_: