Lineage for d8fabc2 (8fab C:106-208)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360924Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2360928Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)
  8. 2360932Domain d8fabc2: 8fab C:106-208 [20884]
    Other proteins in same PDB: d8faba1, d8fabb1, d8fabb2, d8fabc1, d8fabd1, d8fabd2
    part of Fab HIL

Details for d8fabc2

PDB Entry: 8fab (more details), 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution
PDB Compounds: (C:) igg1-lambda hil fab (light chain)

SCOPe Domain Sequences for d8fabc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8fabc2 b.1.1.2 (C:106-208) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspikagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d8fabc2:

Click to download the PDB-style file with coordinates for d8fabc2.
(The format of our PDB-style files is described here.)

Timeline for d8fabc2: