SCOP 1.55: Domain d8fabc2: 8fab C:106-208

Lineage for d8fabc2 (8fab C:106-208)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab HIL (human), lambda L chain [48975] (1 PDB entry)

8. Domain d8fabc2: 8fab C:106-208 [20884]
   Other proteins in same PDB: d8faba1, d8fabb1, d8fabc1, d8fabd1

Details for d8fabc2

PDB Entry: 8fab, 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

SCOP Domain Sequences for d8fabc2:

Sequence; same for both SEQRES and ATOM records:

>d8fabc2 b.1.1.2 (C:106-208) Immunoglobulin (constant domains of L and H chains) {Fab HIL (human), lambda L chain}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspikagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d8fabc2:

• d8fabc2 appears in SCOP 1.57
  
• d8fabc2 appears in the current release, SCOPe 2.08