SCOPe 2.04: Domain d8fabb2: 8fab B:122-223

Lineage for d8fabb2 (8fab B:122-223)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

Domain d8fabb2: 8fab B:122-223 [20883]
Other proteins in same PDB: d8faba1, d8faba2, d8fabb1, d8fabc1, d8fabc2, d8fabd1
part of Fab HIL

Details for d8fabb2

PDB Entry: 8fab (more details), 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

PDB Compounds: (B:) igg1-lambda hil fab (heavy chain)

SCOPe Domain Sequences for d8fabb2:

Sequence, based on SEQRES records: (download)

>d8fabb2 b.1.1.2 (B:122-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d8fabb2 b.1.1.2 (B:122-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d8fabb2:

Click to download the PDB-style file with coordinates for d8fabb2.
(The format of our PDB-style files is described here.)

Timeline for d8fabb2: