Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries) |
Domain d3c6se2: 3c6s E:108-211 [208811] Other proteins in same PDB: d3c6sa1, d3c6sc1, d3c6se1, d3c6sg1 automated match to d1dqdl2 complexed with pd |
PDB Entry: 3c6s (more details), 1.8 Å
SCOPe Domain Sequences for d3c6se2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c6se2 b.1.1.2 (E:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d3c6se2: