Lineage for d1igyd4 (1igy D:363-474)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655861Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 655913Species Mouse (Mus musculus) [TaxId:10090] [88591] (2 PDB entries)
  8. 655917Domain d1igyd4: 1igy D:363-474 [20881]
    Other proteins in same PDB: d1igya1, d1igya2, d1igyb1, d1igyb2, d1igyb3, d1igyc1, d1igyc2, d1igyd1, d1igyd2, d1igyd3
    part of intact IgG1 antibody Mab61.1.3
    complexed with fuc, gal, man, nag

Details for d1igyd4

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin
PDB Compounds: (D:) igg1 intact antibody mab61.1.3

SCOP Domain Sequences for d1igyd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyd4 b.1.1.2 (D:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kprapqvytipppkeqmakdkvsltcmitdffpeditvewqsdgqapenykntqpimdtd
gsyfvysklnvqksnweagntftcsvlheglhnhhtekslsh

SCOP Domain Coordinates for d1igyd4:

Click to download the PDB-style file with coordinates for d1igyd4.
(The format of our PDB-style files is described here.)

Timeline for d1igyd4: