Lineage for d3c6sc2 (3c6s C:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752429Domain d3c6sc2: 3c6s C:108-213 [208809]
    Other proteins in same PDB: d3c6sa1, d3c6sb_, d3c6sc1, d3c6sd_, d3c6se1, d3c6sf_, d3c6sg1, d3c6sh_
    automated match to d1dqdl2
    complexed with pd

Details for d3c6sc2

PDB Entry: 3c6s (more details), 1.8 Å

PDB Description: crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag pentadecasaccharide
PDB Compounds: (C:) Fab F22-4 light chain

SCOPe Domain Sequences for d3c6sc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c6sc2 b.1.1.2 (C:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d3c6sc2:

Click to download the PDB-style file with coordinates for d3c6sc2.
(The format of our PDB-style files is described here.)

Timeline for d3c6sc2: