SCOPe 2.08: Domain d3c6pa2: 3c6p A:101-160

Lineage for d3c6pa2 (3c6p A:101-160)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.0: automated matches [227205] (1 protein)
   not a true family

6. Protein automated matches [226937] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225249] (9 PDB entries)

8. Domain d3c6pa2: 3c6p A:101-160 [208805]
   Other proteins in same PDB: d3c6pa1
   automated match to d1p22b1
   complexed with 2s3, ihp

Details for d3c6pa2

PDB Entry: 3c6p, 2.7 Å

PDB Description: small molecule agonists and antagonists of f-box protein-substrate interactions in auxin perception and signaling

PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d3c6pa2:

Sequence; same for both SEQRES and ATOM records:

>d3c6pa2 a.157.1.0 (A:101-160) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lilaanylniknlldltcqtvadmikgktpeeirttfnikndftpeeeeevrrenqwafe

Timeline for d3c6pa2:

• d3c6pa2 first appeared in SCOPe 2.03
  
• d3c6pa2 appears in SCOPe 2.07