SCOPe 2.08: Domain d3c6pa1: 3c6p A:8-58

Lineage for d3c6pa1 (3c6p A:8-58)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225248] (4 PDB entries)

8. Domain d3c6pa1: 3c6p A:8-58 [208804]
   Other proteins in same PDB: d3c6pa2
   automated match to d2ovra2
   complexed with 2s3, ihp

Details for d3c6pa1

PDB Entry: 3c6p, 2.7 Å

PDB Description: small molecule agonists and antagonists of f-box protein-substrate interactions in auxin perception and signaling

PDB Compounds: (A:) SKP1-like protein 1A

SCOPe Domain Sequences for d3c6pa1:

Sequence, based on SEQRES records:

>d3c6pa1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkssdgesfeveeavalesqtiahmveddcvdngvplpnvtskilakviey

Sequence, based on observed residues (ATOM records):

>d3c6pa1 d.42.1.0 (A:8-58) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
lkseavalesqtiaplpnvtskilakviey

Timeline for d3c6pa1:

• d3c6pa1 first appeared in SCOPe 2.03
  
• d3c6pa1 appears in SCOPe 2.07