| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88586] (1 PDB entry) |
| Domain d1igyd3: 1igy D:236-361 [20880] Other proteins in same PDB: d1igya1, d1igya2, d1igyb1, d1igyb2, d1igyb4, d1igyc1, d1igyc2, d1igyd1, d1igyd2, d1igyd4 part of intact IgG1 antibody Mab61.1.3 |
PDB Entry: 1igy (more details), 3.2 Å
SCOPe Domain Sequences for d1igyd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igyd3 b.1.1.2 (D:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus) [TaxId: 10090]}
gckpcictvpevssvfifppkpkdtllitvtpkvtcvvvdiskddpevqfswfvdnvevh
taqtqpreeqfnstfrvvsalpimhqdwlngkefkcrvnsaafpapiektisktkg
Timeline for d1igyd3: