SCOPe 2.04: Domain d3c5ja1: 3c5j A:3-81

Lineage for d3c5ja1 (3c5j A:3-81)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)

8. Domain d3c5ja1: 3c5j A:3-81 [208793]
   Other proteins in same PDB: d3c5ja2, d3c5jb1, d3c5jb2
   automated match to d1fv1a2
   complexed with nag, so4

Details for d3c5ja1

PDB Entry: 3c5j, 1.8 Å

PDB Description: crystal structure of hla dr52c

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d3c5ja1:

Sequence; same for both SEQRES and ATOM records:

>d3c5ja1 d.19.1.1 (A:3-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
eehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalan
iavdkanleimtkrsnytp

Timeline for d3c5ja1:

• d3c5ja1 first appeared in SCOPe 2.03
  
• d3c5ja1 appears in SCOPe 2.05
  
• d3c5ja1 appears in the current release, SCOPe 2.08