Lineage for d3c5cd_ (3c5c D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598123Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)
  8. 1598146Domain d3c5cd_: 3c5c D: [208792]
    automated match to d3gftc_
    complexed with gdp, mg, unx

Details for d3c5cd_

PDB Entry: 3c5c (more details), 1.85 Å

PDB Description: crystal structure of human ras-like, family 12 protein in complex with gdp
PDB Compounds: (D:) RAS-like protein 12

SCOPe Domain Sequences for d3c5cd_:

Sequence, based on SEQRES records: (download)

>d3c5cd_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadl
dtprncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldm
aqyrqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr

Sequence, based on observed residues (ATOM records): (download)

>d3c5cd_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadl
rncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldmaqy
rqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr

SCOPe Domain Coordinates for d3c5cd_:

Click to download the PDB-style file with coordinates for d3c5cd_.
(The format of our PDB-style files is described here.)

Timeline for d3c5cd_: