SCOPe 2.03: Domain d3c5cb_: 3c5c B:

Lineage for d3c5cb_ (3c5c B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (58 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (75 PDB entries)

8. Domain d3c5cb_: 3c5c B: [208790]
   automated match to d3gftc_
   complexed with gdp, mg, unx

Details for d3c5cb_

PDB Entry: 3c5c, 1.85 Å

PDB Description: crystal structure of human ras-like, family 12 protein in complex with gdp

PDB Compounds: (B:) RAS-like protein 12

SCOPe Domain Sequences for d3c5cb_:

Sequence; same for both SEQRES and ATOM records:

>d3c5cb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
levnlailgrrgagksaltvkfltkrfiseydpnledtysseetvdhqpvhlrvmdtadl
dtprncerylnwahaflvvysvdsrqsfdssssylellalhaketqrsipalllgnkldm
aqyrqvtkaegvalagrfgclffevsacldfehvqhvfheavrearr

Timeline for d3c5cb_:

• d3c5cb_ is new in SCOPe 2.03-stable
  
• d3c5cb_ appears in SCOPe 2.04
  
• d3c5cb_ appears in the current release, SCOPe 2.08