Lineage for d1igyd2 (1igy D:114-235)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549508Domain d1igyd2: 1igy D:114-235 [20879]
    Other proteins in same PDB: d1igya1, d1igya2, d1igyb1, d1igyb3, d1igyb4, d1igyc1, d1igyc2, d1igyd1, d1igyd3, d1igyd4
    part of intact IgG1 antibody Mab61.1.3
    complexed with fuc, gal, man, nag

Details for d1igyd2

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyd2 b.1.1.2 (D:114-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1igyd2:

Click to download the PDB-style file with coordinates for d1igyd2.
(The format of our PDB-style files is described here.)

Timeline for d1igyd2: