SCOPe 2.08: Domain d3c4jb1: 3c4j B:0-240

Lineage for d3c4jb1 (3c4j B:0-240)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188756] (8 PDB entries)

8. Domain d3c4jb1: 3c4j B:0-240 [208783]
   Other proteins in same PDB: d3c4ja2, d3c4jb2
   automated match to d1b0ua_
   complexed with ags, mg

Details for d3c4jb1

PDB Entry: 3c4j, 2.33 Å

PDB Description: abc protein artp in complex with atp-gamma-s

PDB Compounds: (B:) Amino acid ABC transporter (ArtP)

SCOPe Domain Sequences for d3c4jb1:

Sequence; same for both SEQRES and ATOM records:

>d3c4jb1 c.37.1.0 (B:0-240) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
qmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegeii
idginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakame
lldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsvm
kqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflskv
f

Timeline for d3c4jb1:

• d3c4jb1 first appeared in SCOPe 2.03, called d3c4jb_
  
• d3c4jb1 appears in SCOPe 2.07