SCOP 1.73: Domain d1igyc2: 1igy C:108-214

Lineage for d1igyc2 (1igy C:108-214)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1igyc2: 1igy C:108-214 [20878]
   Other proteins in same PDB: d1igya1, d1igyb1, d1igyb2, d1igyb3, d1igyb4, d1igyc1, d1igyd1, d1igyd2, d1igyd3, d1igyd4
   part of intact IgG1 antibody Mab61.1.3
   complexed with fuc, gal, man, nag

Details for d1igyc2

PDB Entry: 1igy, 3.2 Å

PDB Description: structure of immunoglobulin

PDB Compounds: (C:) igg1 intact antibody mab61.1.3

SCOP Domain Sequences for d1igyc2:

Sequence; same for both SEQRES and ATOM records:

>d1igyc2 b.1.1.2 (C:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1igyc2:

• d1igyc2 first appeared (with stable ids) in SCOP 1.55
  
• d1igyc2 appears in SCOP 1.71
  
• d1igyc2 appears in SCOP 1.75
  
• d1igyc2 appears in the current release, SCOPe 2.08