SCOP 1.63: Domain d1igyc2: 1igy C:108-214

Lineage for d1igyc2 (1igy C:108-214)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain [48974] (1 PDB entry)

8. Domain d1igyc2: 1igy C:108-214 [20878]
   Other proteins in same PDB: d1igya1, d1igyb1, d1igyc1, d1igyd1

Details for d1igyc2

PDB Entry: 1igy, 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyc2:

Sequence; same for both SEQRES and ATOM records:

>d1igyc2 b.1.1.2 (C:108-214) Immunoglobulin (constant domains of L and H chains) {Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1igyc2:

• d1igyc2 first appeared (with stable ids) in SCOP 1.55
  
• d1igyc2 appears in SCOP 1.61
  
• d1igyc2 appears in SCOP 1.65
  
• d1igyc2 appears in the current release, SCOPe 2.08